PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E03261.1.p
Common NameEUGRSUZ_E03261
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 357aa    MW: 38391.6 Da    PI: 8.6224
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E03261.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-393391462
            zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                      + lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Eucgr.E03261.1.p 33 QPLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 91
                      679*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-333489IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5253589IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-263689IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MIDEKRLNNS MASTGSPLME KNTPPQQQQQ QLQPLKCPRC DSSNTKFCYY NNYSLSQPRH  60
FCKACKRYWT RGGTLRNVPV GGGCRKNKRV KRPASASATD TAPSSSASAT SDHHPPPHKT  120
HMENLSSSCS NHNSNPMNLG PLFYGNPADQ MSNNLAFPRL TSSSSLYDLH PQLSALGLGF  180
SSSAIIPANS CADTSSLQEG FNANNASGLN VQDLAQITNP LLLPSYSSMF GTSSSPSSSS  240
SCSTTTTIAS LLASSFHHQQ QKFINASGLR ESRALVHNNF KPMSPVEEFQ GLRSNSEVRI  300
EGGQSRNIGW NGSIPCQNPV DQIGLSADPG SICWSSLNVG NSWHDPTSIG LHQSLL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E03261.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010057393.10.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLA0A059C9E60.0A0A059C9E6_EUCGR; Uncharacterized protein
STRINGVIT_10s0003g00040.t012e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-34Dof family protein